SCOP 1.73: Domain d2g8ea1: 2g8e A:33-354

Lineage for d2g8ea1 (2g8e A:33-354)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
   includes the N-terminal 'sequence' domain I

7. Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (8 PDB entries)

8. Domain d2g8ea1: 2g8e A:33-354 [134769]
   automatically matched to d1tloa_
   complexed with ca, d5g, mes

Details for d2g8ea1

PDB Entry: 2g8e, 2.25 Å

PDB Description: calpain 1 proteolytic core in complex with snj-1715, a cyclic hemiacetal-type inhibitor

PDB Compounds: (A:) Calpain-1 catalytic subunit

SCOP Domain Sequences for d2g8ea1:

Sequence; same for both SEQRES and ATOM records:

>d2g8ea1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt

Timeline for d2g8ea1:

• d2g8ea1 is new in SCOP 1.73
  
• d2g8ea1 appears in SCOP 1.75
  
• d2g8ea1 appears in the current release, SCOPe 2.08, called d2g8ea2