| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
| Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
| Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (10 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [117725] (2 PDB entries) Uniprot P95313 |
| Domain d2g4od_: 2g4o D: [134607] automated match to d1w0da_ complexed with cl, so4 |
PDB Entry: 2g4o (more details), 2 Å
SCOPe Domain Sequences for d2g4od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4od_ c.77.1.1 (D:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]}
msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
ehdaaarvdraveahlatrgserlatsdvgeriaaal
Timeline for d2g4od_: