SCOPe 2.02: Domain d2g4ob_: 2g4o B:

Lineage for d2g4ob_ (2g4o B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (10 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117725] (2 PDB entries)
   Uniprot P95313

8. Domain d2g4ob_: 2g4o B: [134605]
   automated match to d1w0da_
   complexed with cl, so4

Details for d2g4ob_

PDB Entry: 2g4o, 2 Å

PDB Description: anomalous substructure of 3-isopropylmalate dehydrogenase

PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d2g4ob_:

Sequence; same for both SEQRES and ATOM records:

>d2g4ob_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]}
msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
ehdaaarvdraveahlatrgserlatsdvgeriaaal

Timeline for d2g4ob_:

• d2g4ob_ first appeared in SCOP 1.73, called d2g4ob1
  
• d2g4ob_ appears in SCOPe 2.01
  
• d2g4ob_ appears in SCOPe 2.03
  
• d2g4ob_ appears in the current release, SCOPe 2.08, called d2g4ob2