Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein automated matches [190241] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187321] (16 PDB entries) |
Domain d2g3tb_: 2g3t B: [134573] automated match to d2b3ua1 |
PDB Entry: 2g3t (more details), 1.8 Å
SCOPe Domain Sequences for d2g3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3tb_ d.108.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate
Timeline for d2g3tb_: