PDB entry 2g3t

View 2g3t on RCSB PDB site
Description: Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT)
Class: transferase
Keywords: alpha / beta fold, TRANSFERASE
Deposited on 2006-02-21, released 2006-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g3ta_
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g3tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g3tA (A:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmateelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3tA (A:)
    kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
    hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
    ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g3tB (B:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmateelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3tB (B:)
    kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
    hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
    ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate