SCOPe 2.08: Domain d2g3ta_: 2g3t A:

Lineage for d2g3ta_ (2g3t A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein automated matches [190241] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187321] (16 PDB entries)

8. Domain d2g3ta_: 2g3t A: [134572]
   automated match to d2b3ua1

Details for d2g3ta_

PDB Entry: 2g3t, 1.8 Å

PDB Description: crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)

PDB Compounds: (A:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2g3ta_:

Sequence; same for both SEQRES and ATOM records:

>d2g3ta_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee

Timeline for d2g3ta_:

• d2g3ta_ first appeared in SCOP 1.73, called d2g3ta1
  
• d2g3ta_ appears in SCOPe 2.07