![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187321] (9 PDB entries) |
![]() | Domain d2g3ta_: 2g3t A: [134572] automated match to d2b3ua1 |
PDB Entry: 2g3t (more details), 1.8 Å
SCOPe Domain Sequences for d2g3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3ta_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
Timeline for d2g3ta_: