Lineage for d2g3ta1 (2g3t A:3-169)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731033Protein Diamine acetyltransferase 1 [143652] (1 species)
  7. 731034Species Human (Homo sapiens) [TaxId:9606] [143653] (10 PDB entries)
  8. 731037Domain d2g3ta1: 2g3t A:3-169 [134572]
    automatically matched to 2F5I A:3-169

Details for d2g3ta1

PDB Entry: 2g3t (more details), 1.8 Å

PDB Description: crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
PDB Compounds: (A:) Diamine acetyltransferase 1

SCOP Domain Sequences for d2g3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3ta1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmat

SCOP Domain Coordinates for d2g3ta1:

Click to download the PDB-style file with coordinates for d2g3ta1.
(The format of our PDB-style files is described here.)

Timeline for d2g3ta1: