Class a: All alpha proteins [46456] (258 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins) |
Protein Putative transcriptional regulator [140909] (1 species) |
Species Rhodococcus sp. rha1 [TaxId:101510] [140910] (1 PDB entry) |
Domain d2g3ba2: 2g3b A:74-189 [134559] Other proteins in same PDB: d2g3ba1, d2g3bb1 complexed with gol |
PDB Entry: 2g3b (more details), 2 Å
SCOP Domain Sequences for d2g3ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3ba2 a.121.1.1 (A:74-189) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} dsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplarttaawvseiadai vqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshllgaidvvms
Timeline for d2g3ba2: