Lineage for d2g3bb2 (2g3b B:74-189)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647677Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 647678Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 647679Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)
  6. 647768Protein Putative transcriptional regulator [140909] (1 species)
  7. 647769Species Rhodococcus sp. rha1 [TaxId:101510] [140910] (1 PDB entry)
  8. 647771Domain d2g3bb2: 2g3b B:74-189 [134561]
    Other proteins in same PDB: d2g3ba1, d2g3bb1
    automatically matched to 2G3B A:74-189
    complexed with gol

Details for d2g3bb2

PDB Entry: 2g3b (more details), 2 Å

PDB Description: crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp.
PDB Compounds: (B:) Putative tetR-family transcriptional regulator

SCOP Domain Sequences for d2g3bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3bb2 a.121.1.1 (B:74-189) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]}
dsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplarttaawvseiadai
vqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshllgaidvvms

SCOP Domain Coordinates for d2g3bb2:

Click to download the PDB-style file with coordinates for d2g3bb2.
(The format of our PDB-style files is described here.)

Timeline for d2g3bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g3bb1