SCOPe 2.08: Domain d2g3ba2: 2g3b A:74-189

Lineage for d2g3ba2 (2g3b A:74-189)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Putative transcriptional regulator [140909] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [140910] (1 PDB entry)

8. Domain d2g3ba2: 2g3b A:74-189 [134559]
   Other proteins in same PDB: d2g3ba1, d2g3bb1
   complexed with gol

Details for d2g3ba2

PDB Entry: 2g3b, 2 Å

PDB Description: crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp.

PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2g3ba2:

Sequence; same for both SEQRES and ATOM records:

>d2g3ba2 a.121.1.1 (A:74-189) Putative transcriptional regulator {Rhodococcus sp. RHA1 [TaxId: 101510]}
dsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplarttaawvseiadai
vqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshllgaidvvms

Timeline for d2g3ba2:

• d2g3ba2 first appeared in SCOP 1.73
  
• d2g3ba2 appears in SCOPe 2.07