Lineage for d2g3ba1 (2g3b A:2-73)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634637Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins)
  6. 634726Protein Putative transcriptional regulator [140177] (1 species)
  7. 634727Species Rhodococcus sp. rha1 [TaxId:101510] [140178] (1 PDB entry)
  8. 634728Domain d2g3ba1: 2g3b A:2-73 [134558]
    Other proteins in same PDB: d2g3ba2, d2g3bb2
    complexed with gol

Details for d2g3ba1

PDB Entry: 2g3b (more details), 2 Å

PDB Description: crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp.
PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOP Domain Sequences for d2g3ba1:

Sequence, based on SEQRES records: (download)

>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]}
serrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyindr
arayrsegegsg

Sequence, based on observed residues (ATOM records): (download)

>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]}
serrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyindr
arayrsegegg

SCOP Domain Coordinates for d2g3ba1:

Click to download the PDB-style file with coordinates for d2g3ba1.
(The format of our PDB-style files is described here.)

Timeline for d2g3ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g3ba2