Lineage for d2fzvd_ (2fzv D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102693Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 protein domains)
    Pfam PF03358
  6. 2102711Protein Putative arsenical resistance protein [142051] (1 species)
  7. 2102712Species Shigella flexneri [TaxId:623] [142052] (1 PDB entry)
    Uniprot Q7UC03 1-233
  8. 2102716Domain d2fzvd_: 2fzv D: [134481]
    Other proteins in same PDB: d2fzva2, d2fzvb3, d2fzvc3
    automated match to d2fzva1
    complexed with ca, cl

Details for d2fzvd_

PDB Entry: 2fzv (more details), 1.7 Å

PDB Description: crystal structure of an apo form of a flavin-binding protein from shigella flexneri
PDB Compounds: (D:) putative arsenical resistance protein

SCOPe Domain Sequences for d2fzvd_:

Sequence, based on SEQRES records: (download)

>d2fzvd_ c.23.5.4 (D:) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]}
mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
qidhlplemagirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakaf
qefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvideatdls
si

Sequence, based on observed residues (ATOM records): (download)

>d2fzvd_ c.23.5.4 (D:) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]}
mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
qidhlprptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakafqefdaa
grmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvideatdlssi

SCOPe Domain Coordinates for d2fzvd_:

Click to download the PDB-style file with coordinates for d2fzvd_.
(The format of our PDB-style files is described here.)

Timeline for d2fzvd_: