PDB entry 2fzv

View 2fzv on RCSB PDB site
Description: Crystal Structure of an apo form of a Flavin-binding Protein from Shigella flexneri
Class: structural genomics, unknown function
Keywords: Flavin binding Protein, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-02-10, released 2006-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative arsenical resistance protein
    Species: Shigella flexneri [TaxId:198215]
    Gene: AAP17869
    Database cross-references and differences (RAF-indexed):
    • GB AAP17869 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2fzva1, d2fzva2
  • Chain 'B':
    Compound: putative arsenical resistance protein
    Species: Shigella flexneri [TaxId:198215]
    Gene: AAP17869
    Database cross-references and differences (RAF-indexed):
    • GB AAP17869 (24-End)
      • cloning artifact (23)
    Domains in SCOPe 2.08: d2fzvb2, d2fzvb3
  • Chain 'C':
    Compound: putative arsenical resistance protein
    Species: Shigella flexneri [TaxId:198215]
    Gene: AAP17869
    Database cross-references and differences (RAF-indexed):
    • GB AAP17869 (24-End)
      • cloning artifact (15-23)
    Domains in SCOPe 2.08: d2fzvc2, d2fzvc3
  • Chain 'D':
    Compound: putative arsenical resistance protein
    Species: Shigella flexneri [TaxId:198215]
    Gene: AAP17869
    Database cross-references and differences (RAF-indexed):
    • GB AAP17869 (24-End)
    Domains in SCOPe 2.08: d2fzvd_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fzvA (A:)
    mhhhhhhssgvdlgtenlyfqsnamrlrhlsdpdslpaldksfaierpalglapdappvr
    illlygslrarsfsrlaveeaarllqffgaetrifdpsdlplpdqvqsddhpavkelral
    sewsegqvwcsperhgqitsvmkaqidhlplemagirptqgrtlavmqvsggsqsfnavn
    tlrllgrwmrmftipnqssiakafqefdaagrmkpspyydriadvmeelvrftalvrphr
    ealtdryserkaaghvideatdlssiaiapqplpesets
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzvA (A:)
    namrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaa
    rllqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvm
    kaqidhlplemagirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiak
    afqefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fzvB (B:)
    mhhhhhhssgvdlgtenlyfqsnamrlrhlsdpdslpaldksfaierpalglapdappvr
    illlygslrarsfsrlaveeaarllqffgaetrifdpsdlplpdqvqsddhpavkelral
    sewsegqvwcsperhgqitsvmkaqidhlplemagirptqgrtlavmqvsggsqsfnavn
    tlrllgrwmrmftipnqssiakafqefdaagrmkpspyydriadvmeelvrftalvrphr
    ealtdryserkaaghvideatdlssiaiapqplpesets
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzvB (B:)
    amrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaar
    llqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmk
    aqidhlplemagirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiaka
    fqefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvideatdl
    ssiaiap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fzvC (C:)
    mhhhhhhssgvdlgtenlyfqsnamrlrhlsdpdslpaldksfaierpalglapdappvr
    illlygslrarsfsrlaveeaarllqffgaetrifdpsdlplpdqvqsddhpavkelral
    sewsegqvwcsperhgqitsvmkaqidhlplemagirptqgrtlavmqvsggsqsfnavn
    tlrllgrwmrmftipnqssiakafqefdaagrmkpspyydriadvmeelvrftalvrphr
    ealtdryserkaaghvideatdlssiaiapqplpesets
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzvC (C:)
    enlyfqsnamrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsr
    laveeaarllqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperh
    gqitsvmkaqidhlplirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqss
    iakafqefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaagh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fzvD (D:)
    mhhhhhhssgvdlgtenlyfqsnamrlrhlsdpdslpaldksfaierpalglapdappvr
    illlygslrarsfsrlaveeaarllqffgaetrifdpsdlplpdqvqsddhpavkelral
    sewsegqvwcsperhgqitsvmkaqidhlplemagirptqgrtlavmqvsggsqsfnavn
    tlrllgrwmrmftipnqssiakafqefdaagrmkpspyydriadvmeelvrftalvrphr
    ealtdryserkaaghvideatdlssiaiapqplpesets
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzvD (D:)
    mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
    lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
    qidhlprptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakafqefdaa
    grmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvideatdlssi