SCOPe 2.08: Domain d2fzva1: 2fzv A:1-233

Lineage for d2fzva1 (2fzv A:1-233)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families)
Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
Pfam PF03358
Protein Putative arsenical resistance protein [142051] (1 species)
Species Shigella flexneri [TaxId:623] [142052] (1 PDB entry)
Uniprot Q7UC03 1-233
Domain d2fzva1: 2fzv A:1-233 [134478]
Other proteins in same PDB: d2fzva2, d2fzvb3, d2fzvc3
complexed with ca, cl

Details for d2fzva1

PDB Entry: 2fzv (more details), 1.7 Å

PDB Description: crystal structure of an apo form of a flavin-binding protein from shigella flexneri

PDB Compounds: (A:) putative arsenical resistance protein

SCOPe Domain Sequences for d2fzva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]}
mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
qidhlplemagirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakaf
qefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvi

SCOPe Domain Coordinates for d2fzva1:

Click to download the PDB-style file with coordinates for d2fzva1.
(The format of our PDB-style files is described here.)

Timeline for d2fzva1: