Lineage for d2fzvd1 (2fzv D:1-233)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692141Family c.23.5.4: NADPH-dependent FMN reductase [89590] (4 proteins)
    Pfam PF03358
  6. 692158Protein Putative arsenical resistance protein [142051] (1 species)
  7. 692159Species Shigella flexneri [TaxId:623] [142052] (1 PDB entry)
  8. 692163Domain d2fzvd1: 2fzv D:1-233 [134481]
    automatically matched to 2FZV A:1-233
    complexed with ca, cl

Details for d2fzvd1

PDB Entry: 2fzv (more details), 1.7 Å

PDB Description: crystal structure of an apo form of a flavin-binding protein from shigella flexneri
PDB Compounds: (D:) putative arsenical resistance protein

SCOP Domain Sequences for d2fzvd1:

Sequence, based on SEQRES records: (download)

>d2fzvd1 c.23.5.4 (D:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]}
mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
qidhlplemagirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakaf
qefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvi

Sequence, based on observed residues (ATOM records): (download)

>d2fzvd1 c.23.5.4 (D:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]}
mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
qidhlprptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakafqefdaa
grmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvi

SCOP Domain Coordinates for d2fzvd1:

Click to download the PDB-style file with coordinates for d2fzvd1.
(The format of our PDB-style files is described here.)

Timeline for d2fzvd1: