SCOPe 2.08: Domain d2fzfb_: 2fzf B:

Lineage for d2fzfb_ (2fzf B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Hypothetical protein PF1190 [140438] (1 species)
   significant sequence similarity to the half-ferritin family

7. Species Pyrococcus furiosus [TaxId:2261] [140439] (1 PDB entry)
   Uniprot Q8U1L6 9-166

8. Domain d2fzfb_: 2fzf B: [134438]
   automated match to d2fzfa1

Details for d2fzfb_

PDB Entry: 2fzf, 2.7 Å

PDB Description: Hypothetical Protein Pfu-1136390-001 From Pyrococcus furiosus

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2fzfb_:

Sequence; same for both SEQRES and ATOM records:

>d2fzfb_ a.25.1.1 (B:) Hypothetical protein PF1190 {Pyrococcus furiosus [TaxId: 2261]}
glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall
rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee
mvkeeekkrlmryladmerghyytlraeyelllnwemy

Timeline for d2fzfb_:

• d2fzfb_ first appeared in SCOP 1.73, called d2fzfb1
  
• d2fzfb_ appears in SCOPe 2.07