![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (5 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (9 proteins) |
![]() | Protein Hypothetical protein PF1190 [140438] (1 species) significant sequence similarity to the half-ferritin family |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [140439] (1 PDB entry) |
![]() | Domain d2fzfb1: 2fzf B:10-167 [134438] automatically matched to 2FZF A:10-167 |
PDB Entry: 2fzf (more details), 2.7 Å
SCOP Domain Sequences for d2fzfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fzfb1 a.25.1.1 (B:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee mvkeeekkrlmryladmerghyytlraeyelllnwemy
Timeline for d2fzfb1: