Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries) |
Domain d2fycc_: 2fyc C: [134363] Other proteins in same PDB: d2fycb1, d2fycd_ automated match to d1nf5a_ complexed with ca, gdu, mes, udp |
PDB Entry: 2fyc (more details), 2 Å
SCOPe Domain Sequences for d2fycc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fycc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]} teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc ekp
Timeline for d2fycc_: