Lineage for d2fycc1 (2fyc C:1-123)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714023Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 714059Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)
  8. 714069Domain d2fycc1: 2fyc C:1-123 [134363]
    Other proteins in same PDB: d2fycb1, d2fycd1
    automatically matched to d1nf5a_
    complexed with ca, gdu, mes, udp; mutant

Details for d2fycc1

PDB Entry: 2fyc (more details), 2 Å

PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose
PDB Compounds: (C:) alpha-lactalbumin

SCOP Domain Sequences for d2fycc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fycc1 d.2.1.2 (C:1-123) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d2fycc1:

Click to download the PDB-style file with coordinates for d2fycc1.
(The format of our PDB-style files is described here.)

Timeline for d2fycc1: