SCOP 1.75: Domain d2fycc1: 2fyc C:1-123

Lineage for d2fycc1 (2fyc C:1-123)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)

8. Domain d2fycc1: 2fyc C:1-123 [134363]
   Other proteins in same PDB: d2fycb1, d2fycd1
   automatically matched to d1nf5a_
   complexed with ca, gdu, mes, udp; mutant

Details for d2fycc1

PDB Entry: 2fyc, 2 Å

PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose

PDB Compounds: (C:) alpha-lactalbumin

SCOP Domain Sequences for d2fycc1:

Sequence; same for both SEQRES and ATOM records:

>d2fycc1 d.2.1.2 (C:1-123) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d2fycc1:

• d2fycc1 first appeared in SCOP 1.73
  
• d2fycc1 is called d2fycc_ in SCOPe 2.01
  
• d2fycc1 appears in the current release, SCOPe 2.08, called d2fycc_