![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
![]() | Protein Potassium channel-related protein MthK [75122] (1 species) |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries) |
![]() | Domain d2fy8b1: 2fy8 B:115-244 [134347] Other proteins in same PDB: d2fy8a2, d2fy8b2, d2fy8c2, d2fy8d2, d2fy8e2, d2fy8f2, d2fy8g2, d2fy8h2 automated match to d2aema1 |
PDB Entry: 2fy8 (more details), 2.79 Å
SCOPe Domain Sequences for d2fy8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fy8b1 c.2.1.9 (B:115-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]} srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan vrgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvi sgrlmsrsid
Timeline for d2fy8b1: