![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
![]() | Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) ![]() |
![]() | Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins) Pfam PF02080 |
![]() | Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species) |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries) |
![]() | Domain d2fy8f2: 2fy8 F:245-336 [134356] Other proteins in same PDB: d2fy8a1, d2fy8b1, d2fy8c1, d2fy8d1, d2fy8e1, d2fy8f1, d2fy8g1, d2fy8h1 automated match to d2aema2 |
PDB Entry: 2fy8 (more details), 2.79 Å
SCOPe Domain Sequences for d2fy8f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fy8f2 d.286.1.1 (F:245-336) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d2fy8f2: