Lineage for d2fy8f2 (2fy8 F:245-336)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009722Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 3009723Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 3009724Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 3009731Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)
  7. 3009732Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries)
  8. 3009742Domain d2fy8f2: 2fy8 F:245-336 [134356]
    Other proteins in same PDB: d2fy8a1, d2fy8b1, d2fy8c1, d2fy8d1, d2fy8e1, d2fy8f1, d2fy8g1, d2fy8h1
    automated match to d2aema2

Details for d2fy8f2

PDB Entry: 2fy8 (more details), 2.79 Å

PDB Description: crystal structure of mthk rck domain in its ligand-free gating-ring form
PDB Compounds: (F:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2fy8f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fy8f2 d.286.1.1 (F:245-336) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d2fy8f2:

Click to download the PDB-style file with coordinates for d2fy8f2.
(The format of our PDB-style files is described here.)

Timeline for d2fy8f2: