SCOPe 2.08: Domain d2fy8h1: 2fy8 H:115-244

Lineage for d2fy8h1 (2fy8 H:115-244)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein Potassium channel-related protein MthK [75122] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries)

8. Domain d2fy8h1: 2fy8 H:115-244 [134359]
   Other proteins in same PDB: d2fy8a2, d2fy8b2, d2fy8c2, d2fy8d2, d2fy8e2, d2fy8f2, d2fy8g2, d2fy8h2
   automated match to d2aema1

Details for d2fy8h1

PDB Entry: 2fy8, 2.79 Å

PDB Description: crystal structure of mthk rck domain in its ligand-free gating-ring form

PDB Compounds: (H:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2fy8h1:

Sequence; same for both SEQRES and ATOM records:

>d2fy8h1 c.2.1.9 (H:115-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan
vrgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvi
sgrlmsrsid

Timeline for d2fy8h1:

• d2fy8h1 first appeared in SCOP 1.73
  
• d2fy8h1 appears in SCOPe 2.07