SCOPe 2.08: Domain d2fwrc1: 2fwr C:257-454

Lineage for d2fwrc1 (2fwr C:257-454)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein DNA repair protein RAD25 [142318] (1 species)
   shares with the DNA helicase UvsW (102396) extra N-terminal alpha+beta subdomain that might be related to the DNA repair protein MutS domain I (55271)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142319] (3 PDB entries)
   Uniprot O29889 237-436! Uniprot O29889 238-434! Uniprot O29889 3-236! Uniprot O29889 4-209

8. Domain d2fwrc1: 2fwr C:257-454 [134257]
   automated match to d2fwra1
   complexed with ipa, po4
   has additional subdomain(s) that are not in the common domain

Details for d2fwrc1

PDB Entry: 2fwr, 2.6 Å

PDB Description: structure of archaeoglobus fulgidis xpb

PDB Compounds: (C:) DNA repair protein RAD25

SCOPe Domain Sequences for d2fwrc1:

Sequence, based on SEQRES records:

>d2fwrc1 c.37.1.19 (C:257-454) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}
khlakytikrifvplaederveyekrekvykqflrargitlrraedfnkivmasgydera
yealraweearriafnsknkirklreilerhrkdkiiiftrhnelvyriskvflipaith
rtsreereeilegfrtgrfraivssqvldegidvpdanvgvimsgsgsareyiqrlgril
rpskgkkeavlyelisrg

Sequence, based on observed residues (ATOM records):

>d2fwrc1 c.37.1.19 (C:257-454) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}
khlakytikrifvplaederveyekrekvykqflrargitrayealraweearriafnsk
nkirklreilerhrkdkiiiftrhnelvyriskvflipaithrtsreereeilegfrtgr
fraivssqvldegidvpdanvgvimsgsgsareyiqrlgrilrpskgkkeavlyelisrg

Timeline for d2fwrc1:

• d2fwrc1 first appeared in SCOP 1.73
  
• d2fwrc1 appears in SCOPe 2.07