Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein DNA repair protein RAD25 [142318] (1 species) shares with the DNA helicase UvsW (102396) extra N-terminal alpha+beta subdomain that might be related to the DNA repair protein MutS domain I (55271) |
Species Archaeoglobus fulgidus [TaxId:2234] [142319] (3 PDB entries) Uniprot O29889 237-436! Uniprot O29889 238-434! Uniprot O29889 3-236! Uniprot O29889 4-209 |
Domain d2fwra2: 2fwr A:23-256 [134254] complexed with ipa, po4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2fwr (more details), 2.6 Å
SCOPe Domain Sequences for d2fwra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwra2 c.37.1.19 (A:23-256) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} miaeiyyergtivvkgdahvphakfdsrsgtyralafryrdiieyfesngiefvdnaadp iptpyfdaeislrdyqekalerwlvdkrgcivlptgsgkthvamaainelstptlivvpt lalaeqwkerlgifgeeyvgefsgrikelkpltvstydsayvnaeklgnrfmllifdevh hlpaesyvqiaqmsiapfrlgltatferedgrheilkevvggkvfelfpdslag
Timeline for d2fwra2: