SCOP 1.73: Domain d2ftqa1: 2ftq A:1-264

Lineage for d2ftqa1 (2ftq A:1-264)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (52 PDB entries)

8. Domain d2ftqa1: 2ftq A:1-264 [134076]
   automatically matched to d1tlca_
   complexed with po4, so4

Details for d2ftqa1

PDB Entry: 2ftq, 1.81 Å

PDB Description: E. coli thymidylate synthase at 1.8 A resolution

PDB Compounds: (A:) Thymidylate synthase

SCOP Domain Sequences for d2ftqa1:

Sequence; same for both SEQRES and ATOM records:

>d2ftqa1 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d2ftqa1:

• d2ftqa1 is new in SCOP 1.73
  
• d2ftqa1 appears in SCOP 1.75
  
• d2ftqa1 appears in the current release, SCOPe 2.08, called d2ftqa_