Lineage for d2ftqa1 (2ftq A:1-264)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871398Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 871399Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 871400Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 871433Protein Thymidylate synthase [55833] (7 species)
  7. 871448Species Escherichia coli [TaxId:562] [55834] (52 PDB entries)
  8. 871464Domain d2ftqa1: 2ftq A:1-264 [134076]
    automatically matched to d1tlca_
    complexed with po4, so4

Details for d2ftqa1

PDB Entry: 2ftq (more details), 1.81 Å

PDB Description: E. coli thymidylate synthase at 1.8 A resolution
PDB Compounds: (A:) Thymidylate synthase

SCOP Domain Sequences for d2ftqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftqa1 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d2ftqa1:

Click to download the PDB-style file with coordinates for d2ftqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ftqa1: