Lineage for d2ftqa_ (2ftq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972223Species Escherichia coli [TaxId:562] [55834] (70 PDB entries)
  8. 2972251Domain d2ftqa_: 2ftq A: [134076]
    automated match to d1an5a_
    complexed with po4, so4

Details for d2ftqa_

PDB Entry: 2ftq (more details), 1.81 Å

PDB Description: E. coli thymidylate synthase at 1.8 A resolution
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2ftqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftqa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d2ftqa_:

Click to download the PDB-style file with coordinates for d2ftqa_.
(The format of our PDB-style files is described here.)

Timeline for d2ftqa_: