Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187102] (9 PDB entries) |
Domain d2ft2a_: 2ft2 A: [134054] automated match to d1ms6a_ complexed with c28 |
PDB Entry: 2ft2 (more details), 1.7 Å
SCOPe Domain Sequences for d2ft2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ft2a_ d.3.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw lvknswghnfgeegyirmarnkgnhcgiasfpsypei
Timeline for d2ft2a_: