PDB entry 2ft2

View 2ft2 on RCSB PDB site
Description: Human Cathepsin S with Inhibitor CRA-29728
Class: transferase
Keywords: cysteine protease, proteinase, 29728, TRANSFERASE
Deposited on 2006-01-23, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ft2a_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ft2b_
  • Heterogens: C28, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ft2A (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ft2A (A:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ft2B (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ft2B (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypei