SCOPe 2.01: Domain d2fsec2: 2fse C:13-81

Lineage for d2fsec2 (2fse C:13-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)

8. Domain d2fsec2: 2fse C:13-81 [134022]
   Other proteins in same PDB: d2fsea1, d2fseb1, d2fseb2, d2fsec1, d2fsed1, d2fsed2
   automatically matched to d1k2da2

Details for d2fsec2

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d2fsec2:

Sequence; same for both SEQRES and ATOM records:

>d2fsec2 d.19.1.1 (C:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

Timeline for d2fsec2:

• d2fsec2 first appeared in SCOP 1.73
  
• d2fsec2 appears in SCOP 1.75
  
• d2fsec2 appears in SCOPe 2.02
  
• d2fsec2 appears in the current release, SCOPe 2.08