| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries) |
| Domain d2fsec2: 2fse C:13-81 [134022] Other proteins in same PDB: d2fsea1, d2fseb1, d2fseb2, d2fsec1, d2fsed1, d2fsed2 automatically matched to d1k2da2 |
PDB Entry: 2fse (more details), 3.1 Å
SCOP Domain Sequences for d2fsec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsec2 d.19.1.1 (C:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp
Timeline for d2fsec2: