SCOP 1.75: Domain d2fsea1: 2fse A:83-181

Lineage for d2fsea1 (2fse A:83-181)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2fsea1: 2fse A:83-181 [134017]
   Other proteins in same PDB: d2fsea2, d2fseb1, d2fseb2, d2fsec2, d2fsed1, d2fsed2
   automatically matched to d1k2da1

Details for d2fsea1

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOP Domain Sequences for d2fsea1:

Sequence; same for both SEQRES and ATOM records:

>d2fsea1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprdd
hlfrkfhyltflpstddfydcevdhwgleeplrkhwefe

Timeline for d2fsea1:

• d2fsea1 first appeared in SCOP 1.73
  
• d2fsea1 appears in SCOPe 2.01
  
• d2fsea1 appears in the current release, SCOPe 2.08