Lineage for d2fpoc1 (2fpo C:10-192)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000354Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 1000355Protein Methylase YhhF [142620] (1 species)
  7. 1000356Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)
    Uniprot P0ADX9 10-192
  8. 1000359Domain d2fpoc1: 2fpo C:10-192 [133911]
    automatically matched to 2FPO A:10-192
    complexed with cl, edo

Details for d2fpoc1

PDB Entry: 2fpo (more details), 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.
PDB Compounds: (C:) methylase yhhF

SCOPe Domain Sequences for d2fpoc1:

Sequence, based on SEQRES records: (download)

>d2fpoc1 c.66.1.46 (C:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records): (download)

>d2fpoc1 c.66.1.46 (C:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdglrpttdrvretlfnwlapvivdaqcldcfagsgalgleal
sryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfr
rglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqrea
q

SCOPe Domain Coordinates for d2fpoc1:

Click to download the PDB-style file with coordinates for d2fpoc1.
(The format of our PDB-style files is described here.)

Timeline for d2fpoc1: