PDB entry 2fpo

View 2fpo on RCSB PDB site
Description: Putative methyltransferase yhhF from Escherichia coli.
Class: transferase
Keywords: structural genomics, putative methyltransferase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2006-01-16, released 2006-02-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylase yhhF
    Species: Escherichia coli [TaxId:83333]
    Gene: yhhF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADX9
      • modified residue (84)
      • modified residue (112)
    Domains in SCOPe 2.01: d2fpoa1
  • Chain 'B':
    Compound: methylase yhhF
    Species: Escherichia coli [TaxId:83333]
    Gene: yhhF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADX9
      • modified residue (84)
      • modified residue (112)
    Domains in SCOPe 2.01: d2fpob1
  • Chain 'C':
    Compound: methylase yhhF
    Species: Escherichia coli [TaxId:83333]
    Gene: yhhF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADX9
      • modified residue (84)
      • modified residue (112)
    Domains in SCOPe 2.01: d2fpoc1
  • Chain 'D':
    Compound: methylase yhhF
    Species: Escherichia coli [TaxId:83333]
    Gene: yhhF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADX9
      • modified residue (84)
      • modified residue (112)
    Domains in SCOPe 2.01: d2fpod1
  • Chain 'E':
    Compound: methylase yhhF
    Species: Escherichia coli [TaxId:83333]
    Gene: yhhF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADX9
      • modified residue (84)
      • modified residue (112)
    Domains in SCOPe 2.01: d2fpoe1
  • Chain 'F':
    Compound: methylase yhhF
    Species: Escherichia coli [TaxId:83333]
    Gene: yhhF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADX9
      • modified residue (84)
      • modified residue (112)
    Domains in SCOPe 2.01: d2fpof1
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fpoA (A:)
    ghmkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcld
    cfagsgalglealsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkg
    tphnivfvdppfrrglleetinlledngwladealiyvesevenglptvpanwslhrekv
    agqvayrlyqreaqgesdadgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpoA (A:)
    gqiriiggqwrgrklpvpdstdrvretlfnwlapvivdaqcldcfagsgalglealsrya
    agatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgll
    eetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fpoB (B:)
    ghmkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcld
    cfagsgalglealsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkg
    tphnivfvdppfrrglleetinlledngwladealiyvesevenglptvpanwslhrekv
    agqvayrlyqreaqgesdadgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpoB (B:)
    gqiriiggqwrgrklpvpdsptdrvretlfnwlapvivdaqcldcfagsgalglealsry
    aagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgl
    leetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fpoC (C:)
    ghmkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcld
    cfagsgalglealsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkg
    tphnivfvdppfrrglleetinlledngwladealiyvesevenglptvpanwslhrekv
    agqvayrlyqreaqgesdadgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpoC (C:)
    gqiriiggqwrgrklpvpdglrpttdrvretlfnwlapvivdaqcldcfagsgalgleal
    sryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfr
    rglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqrea
    q
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fpoD (D:)
    ghmkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcld
    cfagsgalglealsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkg
    tphnivfvdppfrrglleetinlledngwladealiyvesevenglptvpanwslhrekv
    agqvayrlyqreaqgesdadgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpoD (D:)
    gqiriiggqwrgrklpvpdspgtdrvretlfnwlapvivdaqcldcfagsgalglealsr
    yaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrg
    lleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fpoE (E:)
    ghmkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcld
    cfagsgalglealsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkg
    tphnivfvdppfrrglleetinlledngwladealiyvesevenglptvpanwslhrekv
    agqvayrlyqreaqgesdadgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpoE (E:)
    gqiriiggqwrgrklpvpdsptdrvretlfnwlapvivdaqcldcfagsgalglealsry
    aagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgl
    leetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fpoF (F:)
    ghmkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcld
    cfagsgalglealsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkg
    tphnivfvdppfrrglleetinlledngwladealiyvesevenglptvpanwslhrekv
    agqvayrlyqreaqgesdadgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpoF (F:)
    gqiriiggqwrgrklpvpglrpttdrvretlfnwlapvivdaqcldcfagsgalgleals
    ryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrr
    glleetinlledngwladealiyveseveptvpanwslhrekvagqvayrlyqreaq