SCOP 1.73: Domain d2fpob1: 2fpo B:10-192

Lineage for d2fpob1 (2fpo B:10-192)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.46: YhhF-like [142611] (5 proteins)
   Pfam PF03602

6. Protein Methylase YhhF [142620] (1 species)

7. Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)

8. Domain d2fpob1: 2fpo B:10-192 [133910]
   automatically matched to 2FPO A:10-192
   complexed with cl, edo

Details for d2fpob1

PDB Entry: 2fpo, 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.

PDB Compounds: (B:) methylase yhhF

SCOP Domain Sequences for d2fpob1:

Sequence, based on SEQRES records:

>d2fpob1 c.66.1.46 (B:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records):

>d2fpob1 c.66.1.46 (B:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdsptdrvretlfnwlapvivdaqcldcfagsgalglealsry
aagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgl
leetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq

Timeline for d2fpob1:

• d2fpob1 is new in SCOP 1.73
  
• d2fpob1 appears in SCOP 1.75
  
• d2fpob1 appears in the current release, SCOPe 2.08, called d2fpob_