Lineage for d2fpof1 (2fpo F:10-192)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705207Family c.66.1.46: YhhF-like [142611] (5 proteins)
    Pfam PF03602
  6. 705208Protein Methylase YhhF [142620] (1 species)
  7. 705209Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)
  8. 705215Domain d2fpof1: 2fpo F:10-192 [133914]
    automatically matched to 2FPO A:10-192
    complexed with cl, edo

Details for d2fpof1

PDB Entry: 2fpo (more details), 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.
PDB Compounds: (F:) methylase yhhF

SCOP Domain Sequences for d2fpof1:

Sequence, based on SEQRES records: (download)

>d2fpof1 c.66.1.46 (F:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records): (download)

>d2fpof1 c.66.1.46 (F:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpglrpttdrvretlfnwlapvivdaqcldcfagsgalgleals
ryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrr
glleetinlledngwladealiyveseveptvpanwslhrekvagqvayrlyqreaq

SCOP Domain Coordinates for d2fpof1:

Click to download the PDB-style file with coordinates for d2fpof1.
(The format of our PDB-style files is described here.)

Timeline for d2fpof1: