Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) |
Family c.66.1.46: YhhF-like [142611] (5 proteins) Pfam PF03602 |
Protein Methylase YhhF [142620] (1 species) |
Species Escherichia coli [TaxId:562] [142621] (1 PDB entry) Uniprot P0ADX9 10-192 |
Domain d2fpob1: 2fpo B:10-192 [133910] automatically matched to 2FPO A:10-192 complexed with cl, edo |
PDB Entry: 2fpo (more details), 2.05 Å
SCOP Domain Sequences for d2fpob1:
Sequence, based on SEQRES records: (download)
>d2fpob1 c.66.1.46 (B:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr eaq
>d2fpob1 c.66.1.46 (B:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} gqiriiggqwrgrklpvpdsptdrvretlfnwlapvivdaqcldcfagsgalglealsry aagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgl leetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq
Timeline for d2fpob1: