SCOPe 2.08: Domain d2fpob_: 2fpo B:

Lineage for d2fpob_ (2fpo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.46: YhhF-like [142611] (6 proteins)
   Pfam PF03602

6. Protein Methylase YhhF [142620] (1 species)

7. Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)
   Uniprot P0ADX9 10-192

8. Domain d2fpob_: 2fpo B: [133910]
   automated match to d2fpoa1
   complexed with cl, edo

Details for d2fpob_

PDB Entry: 2fpo, 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.

PDB Compounds: (B:) methylase yhhF

SCOPe Domain Sequences for d2fpob_:

Sequence, based on SEQRES records:

>d2fpob_ c.66.1.46 (B:) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records):

>d2fpob_ c.66.1.46 (B:) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdsptdrvretlfnwlapvivdaqcldcfagsgalglealsry
aagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgl
leetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq

Timeline for d2fpob_:

• d2fpob_ first appeared in SCOP 1.73, called d2fpob1
  
• d2fpob_ appears in SCOPe 2.07