Lineage for d2fo0a2 (2fo0 A:139-239)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035347Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1035348Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1035349Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1035630Protein Proto-oncogen tyrosine kinase [55573] (1 species)
  7. 1035631Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries)
  8. 1035632Domain d2fo0a2: 2fo0 A:139-239 [133863]
    Other proteins in same PDB: d2fo0a1, d2fo0a3
    automatically matched to d1ab2__
    complexed with gol, myr, p16

Details for d2fo0a2

PDB Entry: 2fo0 (more details), 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOPe Domain Sequences for d2fo0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo0a2 d.93.1.1 (A:139-239) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
nslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrinta
sdgklyvssesrfntlaelvhhhstvadglittlhypapkr

SCOPe Domain Coordinates for d2fo0a2:

Click to download the PDB-style file with coordinates for d2fo0a2.
(The format of our PDB-style files is described here.)

Timeline for d2fo0a2: