![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (32 proteins) Pfam PF00017 |
![]() | Protein Proto-oncogen tyrosine kinase [55573] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries) |
![]() | Domain d2fo0a2: 2fo0 A:139-239 [133863] Other proteins in same PDB: d2fo0a1, d2fo0a3 automatically matched to d1ab2__ complexed with gol, myr, p16; mutant |
PDB Entry: 2fo0 (more details), 2.27 Å
SCOP Domain Sequences for d2fo0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo0a2 d.93.1.1 (A:139-239) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} nslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrinta sdgklyvssesrfntlaelvhhhstvadglittlhypapkr
Timeline for d2fo0a2: