![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [187100] (2 PDB entries) |
![]() | Domain d2fmxa_: 2fmx A: [133796] automated match to d1f6ba_ complexed with gdp, mg, so4 |
PDB Entry: 2fmx (more details), 1.82 Å
SCOPe Domain Sequences for d2fmxa_:
Sequence, based on SEQRES records: (download)
>d2fmxa_ c.37.1.8 (A:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft tfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpilil gnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrw maqyid
>d2fmxa_ c.37.1.8 (A:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft tfdlgrvwknylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidr peaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid
Timeline for d2fmxa_: