Lineage for d2fmxb_ (2fmx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868022Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [187100] (2 PDB entries)
  8. 2868024Domain d2fmxb_: 2fmx B: [133797]
    automated match to d1f6ba_
    complexed with gdp, mg, so4

Details for d2fmxb_

PDB Entry: 2fmx (more details), 1.82 Å

PDB Description: An open conformation of switch I revealed by Sar1-GDP crystal structure at low Mg(2+)
PDB Compounds: (B:) GTP-binding protein SAR1b

SCOPe Domain Sequences for d2fmxb_:

Sequence, based on SEQRES records: (download)

>d2fmxb_ c.37.1.8 (B:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
tfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpilil
gnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrw
maqyid

Sequence, based on observed residues (ATOM records): (download)

>d2fmxb_ c.37.1.8 (B:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkdptlhptseeltiagmtfttfdlgvw
knylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpeaiseer
lremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid

SCOPe Domain Coordinates for d2fmxb_:

Click to download the PDB-style file with coordinates for d2fmxb_.
(The format of our PDB-style files is described here.)

Timeline for d2fmxb_: