![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
![]() | Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
![]() | Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins) |
![]() | Protein Light-harvesting complex subunits [56920] (4 species) |
![]() | Species Rhodoblastus acidophilus [TaxId:1074] [56921] (4 PDB entries) |
![]() | Domain d2fkwo_: 2fkw O: [133681] automated match to d1nkza_ complexed with bcl, lda, rg1 |
PDB Entry: 2fkw (more details), 2.45 Å
SCOPe Domain Sequences for d2fkwo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkwo_ f.3.1.1 (O:) Light-harvesting complex subunits {Rhodoblastus acidophilus [TaxId: 1074]} mnqgkiwtvvnpaigipallgsvtviailvhlailshttwfpaywqggvkkaa
Timeline for d2fkwo_: