Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins) |
Protein Light-harvesting complex subunits [56920] (4 species) |
Species Rhodoblastus acidophilus [TaxId:1074] [56921] (4 PDB entries) |
Domain d2fkwe_: 2fkw E: [133671] automated match to d1nkza_ complexed with bcl, lda, rg1 |
PDB Entry: 2fkw (more details), 2.45 Å
SCOPe Domain Sequences for d2fkwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkwe_ f.3.1.1 (E:) Light-harvesting complex subunits {Rhodoblastus acidophilus [TaxId: 1074]} mnqgkiwtvvnpaigipallgsvtviailvhlailshttwfpaywqggvkkaa
Timeline for d2fkwe_: