Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
Protein Hypothetical protein YfcD [143770] (1 species) |
Species Escherichia coli [TaxId:562] [143771] (1 PDB entry) Uniprot P65556 8-168 |
Domain d2fkba1: 2fkb A:8-168 [133650] Other proteins in same PDB: d2fkbb_, d2fkbc_ complexed with act, gol, mg, so4 |
PDB Entry: 2fkb (more details), 2 Å
SCOPe Domain Sequences for d2fkba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} stewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkdflpgml dataggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfscvshgp falqedevsevcwltpeeitarcdeftpdslkalalwmkrn
Timeline for d2fkba1: