Lineage for d2fkba1 (2fkb A:8-168)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971664Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2971671Protein Hypothetical protein YfcD [143770] (1 species)
  7. 2971672Species Escherichia coli [TaxId:562] [143771] (1 PDB entry)
    Uniprot P65556 8-168
  8. 2971673Domain d2fkba1: 2fkb A:8-168 [133650]
    Other proteins in same PDB: d2fkbb_, d2fkbc_
    complexed with act, gol, mg, so4

Details for d2fkba1

PDB Entry: 2fkb (more details), 2 Å

PDB Description: crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12
PDB Compounds: (A:) Putative Nudix hydrolase yfcD

SCOPe Domain Sequences for d2fkba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]}
stewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkdflpgml
dataggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfscvshgp
falqedevsevcwltpeeitarcdeftpdslkalalwmkrn

SCOPe Domain Coordinates for d2fkba1:

Click to download the PDB-style file with coordinates for d2fkba1.
(The format of our PDB-style files is described here.)

Timeline for d2fkba1: