Lineage for d2fj7h1 (2fj7 H:30-122)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637507Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)
  8. 637554Domain d2fj7h1: 2fj7 H:30-122 [133553]
    Other proteins in same PDB: d2fj7a1, d2fj7b1, d2fj7e1, d2fj7f1
    automatically matched to d1s32d_

Details for d2fj7h1

PDB Entry: 2fj7 (more details), 3.2 Å

PDB Description: crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
PDB Compounds: (H:) histone h2b

SCOP Domain Sequences for d2fj7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj7h1 a.22.1.1 (H:30-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d2fj7h1:

Click to download the PDB-style file with coordinates for d2fj7h1.
(The format of our PDB-style files is described here.)

Timeline for d2fj7h1: