SCOP 1.73: Domain d2fj7d1: 2fj7 D:30-122

Lineage for d2fj7d1 (2fj7 D:30-122)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)

8. Domain d2fj7d1: 2fj7 D:30-122 [133550]
   Other proteins in same PDB: d2fj7a1, d2fj7b1, d2fj7e1, d2fj7f1
   automatically matched to d1s32d_

Details for d2fj7d1

PDB Entry: 2fj7, 3.2 Å

PDB Description: crystal structure of nucleosome core particle containing a poly (da.dt) sequence element

PDB Compounds: (D:) histone h2b

SCOP Domain Sequences for d2fj7d1:

Sequence; same for both SEQRES and ATOM records:

>d2fj7d1 a.22.1.1 (D:30-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d2fj7d1:

• d2fj7d1 is new in SCOP 1.73
  
• d2fj7d1 appears in SCOP 1.75
  
• d2fj7d1 appears in the current release, SCOPe 2.08